PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC001878.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family TALE
Protein Properties Length: 370aa    MW: 41191.6 Da    PI: 7.0732
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC001878.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.13.4e-091111481954
                   HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
      Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                   Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  EcC001878.10 111 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 148
                   564459******************************88 PP

2BELL62.41e-201433072
          BELL 30 lqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
                  +++v+ssFeavag g+a++Y +lA+ka+SrhFrcL+d i++qi
  EcC001878.10  1 MKAVVSSFEAVAGSGAATVYSALASKAMSRHFRCLRDGIVGQI 43
                  89***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075261.2E-15139IPR006563POX domain
PROSITE profilePS5007112.16389152IPR001356Homeobox domain
SMARTSM003895.8E-992156IPR001356Homeobox domain
CDDcd000868.73E-1392153No hitNo description
SuperFamilySSF466891.63E-1793160IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-2895159IPR009057Homeodomain-like
PfamPF059204.2E-18109148IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MKAVVSSFEA VAGSGAATVY SALASKAMSR HFRCLRDGIV GQIQATKKAM GEKDLASPGT  60
TRGETPRLKI IDQALRQQRA FQQMTMMDNH PWRPQRGLPE RSVSVLRAWL FEHFLHPYPS  120
DVDKHILARQ TGLSRSQVSN WFINARVRLW KPMVEEMYME ETREHDNMGS SDGAADLEDD  180
GRPNNHNREA TRVEDQKPTS DQLVRIDSEC FSSIVTSPDK SDQHHHSKMA ATRAPQNHHH  240
HHHHHHHLHP QNSGFGRVSD AYGGMEIDFS SYNHHPVTSA APYSNDGDAS HQNFNGSGGG  300
VSLTLGLQQH GGPSHGVSLA FSSVSQNSLF YPRDHIEDCH PVQYSLLDGE GQTLPYRNLM  360
GAQLLHDLAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A4e-1698156563Homeobox protein Meis2
4xrm_B4e-1698156563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010053224.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_010053225.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-113BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLA0A059CGZ00.0A0A059CGZ0_EUCGR; Uncharacterized protein
STRINGVIT_02s0025g00200.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58662639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-108TALE family protein